"ALOX5" Related Products

Expand

Recombinant Human ALOX5

Cat.No.: ALOX5-26026TH
Product Overview: Recombinant full length Human 5 Lipoxygenase with N terminal proprietary tag; Predicted MWt 100.21 kDa.
Description: This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Protein length: 674 amino acids
Molecular Weight: 100.210kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDK PFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDD WYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKC HKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQS SWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQG NIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANK IVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAH VRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRA MKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRG RKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYD WCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRK NLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI
Sequence Similarities: Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.
Gene Name: ALOX5 arachidonate 5-lipoxygenase [ Homo sapiens ]
Official Symbol: ALOX5
Synonyms: ALOX5; arachidonate 5-lipoxygenase; 5 LOX;
Gene ID: 240
mRNA Refseq: NM_000698
Protein Refseq: NP_000689
MIM: 152390
Uniprot ID: P09917
Chromosome Location: 10q11.2
Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem; Leukotriene synthesis, organism-specific biosystem;
Function: arachidonate 5-lipoxygenase activity; arachidonate 5-lipoxygenase activity; iron ion binding; lipoxygenase activity; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.