Recombinant Human ALOX5AP
Cat.No. : | ALOX5AP-27299TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-161 of Human FLAP, with an N-terminal proprietary tag, Predicted MWt 43.45 kDa |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. |
Protein length : | 161 amino acids |
Molecular Weight : | 43.450kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGR SFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQ VPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLI P |
Sequence Similarities : | Belongs to the MAPEG family. |
Gene Name : | ALOX5AP arachidonate 5-lipoxygenase-activating protein [ Homo sapiens ] |
Official Symbol : | ALOX5AP |
Synonyms : | ALOX5AP; arachidonate 5-lipoxygenase-activating protein; five lipoxygenase activating protein; FLAP; MK 886 binding protein; |
Gene ID : | 241 |
mRNA Refseq : | NM_001204406 |
Protein Refseq : | NP_001191335 |
MIM : | 603700 |
Uniprot ID : | P20292 |
Chromosome Location : | 13q12 |
Pathway : | Eicosanoid Synthesis, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem; Selenium Pathway, organism-specific biosystem; |
Function : | arachidonate 5-lipoxygenase activity; arachidonic acid binding; enzyme activator activity; enzyme binding; NOT glutathione peroxidase activity; |
Products Types
◆ Recombinant Protein | ||
ALOX5AP-295R | Recombinant Rat ALOX5AP Protein, His (Fc)-Avi-tagged | +Inquiry |
ALOX5AP-3336H | Recombinant Human ALOX5AP protein(Met1-Pro161), His-tagged | +Inquiry |
Alox5ap-585M | Recombinant Mouse Alox5ap Protein, MYC/DDK-tagged | +Inquiry |
ALOX5AP-137R | Recombinant Rhesus Macaque ALOX5AP Protein, His (Fc)-Avi-tagged | +Inquiry |
ALOX5AP-484M | Recombinant Mouse ALOX5AP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
ALOX5AP-667HCL | Recombinant Human ALOX5AP cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket