"ALPI" Related Products

Expand

Recombinant Human ALPI

Cat.No.: ALPI-28300TH
Product Overview: Recombinant fragment corresponding to amino acids 74-162 of Human intestinal alkaline phosphatase with an N terminal proprietary tag; Predicted MWt 35.42 kDa.
Description: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is upregulated during small intestinal epithelial cell differentiation.
Protein length: 89 amino acids
Molecular Weight: 35.420kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV
Sequence Similarities: Belongs to the alkaline phosphatase family.
Gene Name: ALPI alkaline phosphatase, intestinal [ Homo sapiens ]
Official Symbol: ALPI
Synonyms: ALPI; alkaline phosphatase, intestinal; intestinal-type alkaline phosphatase;
Gene ID: 248
mRNA Refseq: NM_001631
Protein Refseq: NP_001622
MIM: 171740
Uniprot ID: P09923
Chromosome Location: 2q37.1
Pathway: Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: alkaline phosphatase activity; hydrolase activity; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.