Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human ALPP

Recombinant Human ALPP

   Share
"ALPP" Related Products.
By Species
Human(13)
By Source
+Expand -Collapse
By Tag
His(1)
N/A(5)
T7/His(1)
Cat.No.:
ALPP-31022TH
Product Overview:
Recombinant full length protein of Human Placental alkaline phosphatase protein with an N terminal proprietary tag; predicted mwt: 84.92 kDa.
Description:
There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form. The coding sequence for this form of alkaline phosphatase is unique in that the 3 untranslated region contains multiple copies of an Alu family repeat. In addition, this gene is polymorphic and three common alleles (type 1, type 2 and type 3) for this form of alkaline phosphatase have been well characterized.
Protein length:
535 amino acids
Molecular Weight:
84.920kDa inclusive of tags
Source:
Wheat germ
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAE ALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQ KKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKK AGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASA RQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASL DPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRL LSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLA PGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPE YRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLP LLAGTLLLLETATAP
Sequence Similarities:
Belongs to the alkaline phosphatase family.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.