"ALPP" Related Products

Expand

Recombinant Human ALPP

Cat.No.: ALPP-31022TH
Product Overview: Recombinant full length protein of Human Placental alkaline phosphatase protein with an N terminal proprietary tag; predicted mwt: 84.92 kDa.
Description: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form. The coding sequence for this form of alkaline phosphatase is unique in that the 3 untranslated region contains multiple copies of an Alu family repeat. In addition, this gene is polymorphic and three common alleles (type 1, type 2 and type 3) for this form of alkaline phosphatase have been well characterized.
Protein length: 535 amino acids
Molecular Weight: 84.920kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLGPCMLLLLLLLGLRLQLSLGIIPVEEENPDFWNREAAE ALGAAKKLQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQ KKDKLGPEIPLAMDRFPYVALSKTYNVDKHVPDSGATATA YLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKK AGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASA RQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYP DDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASL DPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRL LSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAI ERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLA PGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPE YRQQSAVPLDEETHAGEDVAVFARGPQAHLVHGVQEQTFI AHVMAFAACLEPYTACDLAPPAGTTDAAHPGRSVVPALLP LLAGTLLLLETATAP
Sequence Similarities: Belongs to the alkaline phosphatase family.
Gene Name: ALPP alkaline phosphatase, placental [ Homo sapiens ]
Official Symbol: ALPP
Synonyms: ALPP; alkaline phosphatase, placental; alkaline phosphatase, placental (Regan isozyme); alkaline phosphatase, placental type; Regan isozyme;
Gene ID: 250
mRNA Refseq: NM_001632
Protein Refseq: NP_001623
MIM: 171800
Uniprot ID: P05187
Chromosome Location: 2q37.1
Pathway: Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function: alkaline phosphatase activity; alkaline phosphatase activity; hydrolase activity; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.