"AMELX" Related Products

Recombinant Human AMELX

Cat.No.: AMELX-27233TH
Product Overview: Recombinant full length Human AMELX with a N terminal proprietary tag: predicted molecular weight 47.08 kDa.
Description: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in this gene cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein length: 191 amino acids
Molecular Weight: 47.080kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLK WYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQ PHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLP PPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPP MFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Sequence Similarities: Belongs to the amelogenin family.
Gene Name: AMELX amelogenin, X-linked [ Homo sapiens ]
Official Symbol: AMELX
Synonyms: AMELX; amelogenin, X-linked; AIH1, amelogenin (X chromosome, amelogenesis imperfecta 1) , AMG; amelogenin, X isoform; amelogenesis imperfecta 1;
Gene ID: 265
mRNA Refseq: NM_001142
Protein Refseq: NP_001133
MIM: 300391
Uniprot ID: Q99217
Chromosome Location: Xp22.31-p22.1
Function: cell surface binding; growth factor activity; hydroxyapatite binding; identical protein binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.