Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human ANP32A

Recombinant Human ANP32A

   Share
"ANP32A" Related Products.
By Species
By Source
+Expand -Collapse
By Tag
His(9)
His & GST(1)
N/A(1)
Cat.No.:
ANP32A-30006TH
Product Overview:
Recombinant full length Human PHAP1 expressed in Saccharomyces cerevisiae; 249 amino acids, MWt 28.6 kDa. Protein is tagged with 26 kDa proprietary tag.
Tissue specificity:
Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate nucleus, corpus cal
Form:
Liquid
Purity:
>90% by SDS-PAGE
Storage buffer:
Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage:
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids:
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDE FEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSG GLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAP DSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDE EEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERG QKRKREPEDEGEDDD
Sequence Similarities:
Belongs to the ANP32 family.Contains 4 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.