"ANP32A" Related Products

Expand
Expand

Recombinant Human ANP32A

Cat.No.: ANP32A-30006TH
Product Overview: Recombinant full length Human PHAP1 expressed in Saccharomyces cerevisiae; 249 amino acids, MWt 28.6 kDa. Protein is tagged with 26 kDa proprietary tag.
Tissue specificity: Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate nucleus, corpus cal
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDE FEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSG GLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAP DSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDE EEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERG QKRKREPEDEGEDDD
Sequence Similarities: Belongs to the ANP32 family.Contains 4 LRR (leucine-rich) repeats.Contains 1 LRRCT domain.
Gene Name: ANP32A acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [ Homo sapiens ]
Official Symbol: ANP32A
Synonyms: ANP32A; acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; C15orf1; acidic leucine-rich nuclear phosphoprotein 32 family member A; I1PP2A; LANP; MAPM; mapmodulin; PHAPI; PP32;
Gene ID: 8125
mRNA Refseq: NM_006305
Protein Refseq: NP_006296
MIM: 600832
Uniprot ID: P39687
Chromosome Location: 15q23
Pathway: Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem; Stabilization of mRNA by HuR, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.