"ANP32C" Related Products

Expand

Recombinant Human ANP32C

Cat.No.: ANP32C-27323TH
Product Overview: Recombinant Full Length Human ANP32C produced in Saccharomyces cerevisiae; 234 amino acids, MWt 26.7 kDa. Protein is tagged with 26 kDa proprietary tag.
Description: Phosphoprotein 32 (PP32) is a tumor suppressor that can inhibit several types of cancers, including prostate and breast cancers. The protein encoded by this gene is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDE FEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEV LAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDL FNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDI EDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEG EEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQK RK
Gene Name: ANP32C acidic (leucine-rich) nuclear phosphoprotein 32 family, member C [ Homo sapiens ]
Official Symbol: ANP32C
Synonyms: ANP32C; acidic (leucine-rich) nuclear phosphoprotein 32 family, member C; acidic leucine-rich nuclear phosphoprotein 32 family member C; PP32R1;
Gene ID: 23520
mRNA Refseq: NM_012403
Protein Refseq: NP_036535
MIM: 606877
Uniprot ID: O43423
Chromosome Location: 4q32.3

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.