"APBB1" Related Products

Expand

Recombinant Human APBB1

Cat.No.: APBB1-28167TH
Product Overview: Recombinant full length Human FE65 with N terminal proprietary tag; Predicted MWt 103.95 kDa.
Description: The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimers disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene products nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimers disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants have been described for this gene but some of their full length sequence is not known.
Protein length: 708 amino acids
Molecular Weight: 103.950kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKL QATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQNQLRRA ATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSEL ELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEE EEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPR EHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQW EPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDE PSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQ LSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQA LLHAQPIISIRVWGVGRDSGRDFAYVARDKLTQMLKCHVF RCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSK LVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVI NGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLG ECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPN AASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVA RRVGWTVRRGVQSLWGSLKPKRLGAHTP
Sequence Similarities: Contains 2 PID domains.Contains 1 WW domain.
Gene Name: APBB1 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) [ Homo sapiens ]
Official Symbol: APBB1
Synonyms: APBB1; amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65); RIR; amyloid beta A4 precursor protein-binding family B member 1; Fe65;
Gene ID: 322
mRNA Refseq: NM_001164
Protein Refseq: NP_001155
MIM: 602709
Uniprot ID: O00213
Chromosome Location: 11p15
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem;
Function: beta-amyloid binding; beta-amyloid binding; chromatin binding; histone binding; proline-rich region binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.