Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human APBB1

Recombinant Human APBB1

   Share
"APBB1" Related Products.
By Species
Human(6)
Mouse(8)
Rat(5)
By Source
+Expand -Collapse
By Tag
His(3)
Cat.No.:
APBB1-28167TH
Product Overview:
Recombinant full length Human FE65 with N terminal proprietary tag; Predicted MWt 103.95 kDa.
Description:
The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimers disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene products nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimers disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants have been described for this gene but some of their full length sequence is not known.
Protein length:
708 amino acids
Molecular Weight:
103.950kDa inclusive of tags
Source:
Wheat germ
Tissue specificity:
Highly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease.
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKL QATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQNQLRRA ATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSEL ELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEE EEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPR EHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQW EPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDE PSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQ LSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQA LLHAQPIISIRVWGVGRDSGRDFAYVARDKLTQMLKCHVF RCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSK LVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVI NGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLG ECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPN AASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVA RRVGWTVRRGVQSLWGSLKPKRLGAHTP
Sequence Similarities:
Contains 2 PID domains.Contains 1 WW domain.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.