Recombinant Human APLP1, His-tagged
Cat.No. : | APLP1-26119TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 274-651 of Human APLP1 with an N-terminal His tag; Predicted MWt 43 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in the cerebral cortex where it is localized to the postsynaptic density (PSD). |
Form : | Lyophilised:Reconstitute with 58 μl aqua dest |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRA KMDLEERRMRQINEVMREWAMADNQSKNLPKADRQALN EHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRR AALEGFLAALQADPPQAERVLLALRRYLRAEQKEQRHT LRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLL DQNPHLAQELRPQIQELLHSEHLGPSELEAPAPGGSSE DKGGLQPPDSKDADTPMTLPKGSTEQDAASPEKEKMNP LEQYERKVNASVPRGFPFHSSEIQRDELAPAGTGVSRE AVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVD PMLTLEEQQLRELQRHGYENPTYRFLEERP |
Sequence Similarities : | Belongs to the APP family. |
Gene Name : | APLP1 amyloid beta (A4) precursor-like protein 1 [ Homo sapiens ] |
Official Symbol : | APLP1 |
Synonyms : | APLP1; amyloid beta (A4) precursor-like protein 1; amyloid-like protein 1; amyloid precursor like protein 1; amyloid like protein 1; APLP; |
Gene ID : | 333 |
mRNA Refseq : | NM_001024807 |
Protein Refseq : | NP_001019978 |
MIM : | 104775 |
Uniprot ID : | P51693 |
Chromosome Location : | 19q |
Function : | alpha-2A adrenergic receptor binding; alpha-2B adrenergic receptor binding; alpha-2C adrenergic receptor binding; heparin binding; identical protein binding; |
Products Types
◆ Recombinant Protein | ||
APLP1-394H | Recombinant Human APLP1 Protein, His-tagged | +Inquiry |
APLP1-623M | Recombinant Mouse APLP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Aplp1-295M | Recombinant Mouse Aplp1 Protein, His-tagged | +Inquiry |
APLP1-1102H | Recombinant Human APLP1 protein(Met1-Glu580), His-tagged | +Inquiry |
Aplp1-3443M | Recombinant Mouse Aplp1, His-tagged | +Inquiry |
◆ Lysates | ||
APLP1-1031HCL | Recombinant Human APLP1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (20)
Ask a questionAPLP1 is considered as one of the therapeutic directions for neurodegenerative diseases, and related research and development is ongoing.
APLP1 is closely related to the formation of neuronal axons, which can regulate the formation and development of neuronal axons.
APLP1 plays an important role in synaptic plasticity, regulating the formation and plasticity of synapses.
Studies have shown that APLP1 is associated with Alzheimer's disease and may be one of the triggers of Alzheimer's disease.
APLP1 is related to beta-amyloid protein, which is one of the main components of beta-amyloid substances.
The physiological functions of APLP1 include cell signaling, neuronal development, neuronal protection, metabolic regulation and so on.
Mutations in the APLP1 are associated with a variety of diseases, including cancer and neurological disorders.
APLP1 is associated with the repair of neuronal synapses and can promote the reconstruction and repair of neuronal synapses.
It can be used as a target for drug development, and drug studies targeting APLP1 are ongoing.
APLP1 can be used in the treatment of neurodegenerative diseases, stroke, metabolic diseases and other aspects.
APLP1 plays an important role in cell signaling and can participate in a series of biological processes such as cell proliferation, apoptosis and differentiation.
APLP1 can participate in the formation and stability of neuron cell membrane, and plays an important role in the development and maintenance of cell membrane.
APLP1 can be applied to neurodegenerative diseases, cancer, and metabolic diseases.
Some studies suggest that APLP1 may have an effect on memory and learning ability.
APLP1 has been found to be associated with a variety of cancers, and it may serve as a cancer marker or therapeutic target.
APLP1 can play an antioxidant role by inhibiting the generation of free radicals and regulating the activity of antioxidant enzymes.
APLP1 plays an important biological role in inflammatory response, and studies have shown that it can be involved in regulating the body's immune response and cytokine play.
The preparation methods of APLP1 include genetic engineering technology, cell culture technology, etc.
Studies have shown that APLP1 can improve the living environment of adult nerve cells and protect nerve cells from damage.
Studies have shown that APLP1 plays an important role in the development and protection of neurons and can prevent neuronal apoptosis.
Customer Reviews (4)
Write a reviewLabeling effect in Western blot is very good, and operations such as fluorescent labeling can be performed to facilitate subsequent detection and analysis.
Production process of APLP1 pays attention to harmonious coexistence with nature, and realizes zero pollution in the production process, demonstrating its persistent pursuit of environmental protection.
The same batch of experiments are very similar, and the reproducibility is very high.
Preparation process is strictly controlled to ensure the quality and safety of the product.
Ask a Question for All APLP1 Products
Required fields are marked with *
My Review for All APLP1 Products
Required fields are marked with *
Inquiry Basket