"APOF" Related Products

Expand
Expand

Recombinant Human APOF

Cat.No.: APOF-27294TH
Product Overview: Recombinant full length Human Apolipoprotein F with N terminal proprietary tag; Predicted MWt 58.01 kDa.
Description: The product of this gene is one of the minor apolipoproteins found in plasma. This protein forms complexes with lipoproteins and may be involved in transport and/or esterification of cholesterol.
Protein length: 291 amino acids
Molecular Weight: 58.010kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed by the liver and secreted in plasma.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGF SHMAPLPKFLVSLALRNDALEEAGCQADVWALQLQLYRQG GVNATQVLIQHLRGLQKGRSTERNVSVEALASALQLLARE QQSTGRVGRSLPTEDCENEKEQAVHNVVQLLPGVGTFYNL GTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGG PMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTK EGLRAISDVSDLEETTTLASFISEVVSSAPYWGWAIIKSY DLDPGAGSLEI
Gene Name: APOF apolipoprotein F [ Homo sapiens ]
Official Symbol: APOF
Synonyms: APOF; apolipoprotein F;
Gene ID: 319
mRNA Refseq: NM_001638
Protein Refseq: NP_001629
Uniprot ID: Q13790
Chromosome Location: 12q13
Function: cholesterol binding; lipid transporter activity; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.