"AQP8" Related Products

Expand
Expand

Recombinant Human AQP8

Cat.No.: AQP8-26532TH
Product Overview: Recombinant full length Human Aquaporin 8 with N terminal proprietary tag; Predicted MWt 54.16 kDa.
Description: Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0).Aquaporin 8 mRNA is found in pancreas and colon but not other tissues.
Protein length: 255 amino acids
Molecular Weight: 54.160kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed only in pancreas and colon.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSA LFIFIGCLSVIENGTDTGLLQPALAHGLALGLVIATLGNI SGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAA LAKAVSPEERFWNASGAAFVTVQEQGQVAGALVAEIILTT LLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSG GCMNPARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIR CFIGDGKTRLILKAR
Sequence Similarities: Belongs to the MIP/aquaporin (TC 1.A.8) family.
Gene Name: AQP8 aquaporin 8 [ Homo sapiens ]
Official Symbol: AQP8
Synonyms: AQP8; aquaporin 8; aquaporin-8;
Gene ID: 343
mRNA Refseq: NM_001169
Protein Refseq: NP_001160
MIM: 603750
Uniprot ID: O94778
Chromosome Location: 16p12
Pathway: Aquaporin-mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Passive Transport by Aquaporins, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem;
Function: transporter activity; water channel activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.