Recombinant Human ARFIP2, His-tagged
Cat.No. : | ARFIP2-27057TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-261 of Human ARFIP2 with an N-terminal His Tag, approximately 30kDa |
- Specification
- Gene Information
- Related Products
Description : | ARFIP2 is a ubiquitously expressed protein implicated in mediating cross talk between RAC and ARF small GTPases. It has been shown that ARFIP2 binds specifically to GTP-bound ARF1 and ARF6, but binds to Rac-GTP and Rac-GDP with similar affinities. The X-ray structure of arfaptin reveals an elongated, crescent-shaped dimer of 3-helix coiled-coils. Structures of arfaptin with Rac bound to either GDP or the slowly hydrolysable analog GMPPNP show that the switch regions adopt similar conformations in both complexes. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 105 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMV SGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPS GPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFG RGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYS LLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCK NGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAAR LEYDAYRTDLEELSLGPRDAGTRGRLESA |
Gene Name : | ARFIP2 ADP-ribosylation factor interacting protein 2 [ Homo sapiens ] |
Official Symbol : | ARFIP2 |
Synonyms : | ARFIP2; ADP-ribosylation factor interacting protein 2; arfaptin-2; arfaptin 2; POR1; |
Gene ID : | 23647 |
mRNA Refseq : | NM_001242854 |
Protein Refseq : | NP_001229783 |
MIM : | 601638 |
Uniprot ID : | P53365 |
Chromosome Location : | 11p15 |
Pathway : | Arf1 pathway, organism-specific biosystem; |
Function : | GTP binding; GTP-dependent protein binding; GTP-dependent protein binding; Rac GTPase binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
Arfip2-1676M | Recombinant Mouse Arfip2 Protein, Myc/DDK-tagged | +Inquiry |
ARFIP2-667M | Recombinant Mouse ARFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARFIP2-414R | Recombinant Rat ARFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARFIP2-754H | Recombinant Human ARFIP2 protein, GST-tagged | +Inquiry |
ARFIP2-758R | Recombinant Rat ARFIP2 Protein | +Inquiry |
◆ Lysates | ||
ARFIP2-8749HCL | Recombinant Human ARFIP2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket