"ARID3A" Related Products

Recombinant Human ARID3A

Cat.No.: ARID3A-28375TH
Product Overview: Recombinant fragment of Human DRIL1 with N terminal proprietary tag; Predicted MW 36.63 kDa.
Description: This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed, with highest expression in skeletal muscle, thalamus, and colon.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
Sequence Similarities: Contains 1 ARID domain.Contains 1 REKLES domain.
Gene Name: ARID3A AT rich interactive domain 3A (BRIGHT-like) [ Homo sapiens ]
Official Symbol: ARID3A
Synonyms: ARID3A; AT rich interactive domain 3A (BRIGHT-like); AT rich interactive domain 3A (BRIGHT like) , dead ringer like 1 (Drosophila) , DRIL1; AT-rich interactive domain-containing protein 3A; BRIGHT;
Gene ID: 1820
mRNA Refseq: NM_005224
Protein Refseq: NP_005215
MIM: 603265
Uniprot ID: Q99856
Chromosome Location: 19p13.3
Pathway: Direct p53 effectors, organism-specific biosystem;
Function: DNA binding; protein homodimerization activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.