Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human BST2

Cat.No. : BST2-26110TH
Product Overview : Recombinant fragment of Human BST2 with N terminal proprietary tag; Predicted MWt 41.25 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.
Protein length : 141 amino acids
Molecular Weight : 41.250kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly exp
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQK GFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGE ITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQD SSSAAAPQLLIVLLGLSALLQ
Sequence Similarities : Belongs to the tetherin family.
Gene Name : BST2 bone marrow stromal cell antigen 2 [ Homo sapiens ]
Official Symbol : BST2
Synonyms : BST2; bone marrow stromal cell antigen 2; bone marrow stromal antigen 2; CD317; tetherin;
Gene ID : 684
mRNA Refseq : NM_004335
Protein Refseq : NP_004326
MIM : 600534
Uniprot ID : Q10589
Chromosome Location : 19p13.2
Function : protein homodimerization activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All BST2 Products

Required fields are marked with *

My Review for All BST2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends