Recombinant Human BST2
Cat.No. : | BST2-26110TH |
Product Overview : | Recombinant fragment of Human BST2 with N terminal proprietary tag; Predicted MWt 41.25 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. |
Protein length : | 141 amino acids |
Molecular Weight : | 41.250kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly exp |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQK GFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGE ITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQD SSSAAAPQLLIVLLGLSALLQ |
Sequence Similarities : | Belongs to the tetherin family. |
Gene Name : | BST2 bone marrow stromal cell antigen 2 [ Homo sapiens ] |
Official Symbol : | BST2 |
Synonyms : | BST2; bone marrow stromal cell antigen 2; bone marrow stromal antigen 2; CD317; tetherin; |
Gene ID : | 684 |
mRNA Refseq : | NM_004335 |
Protein Refseq : | NP_004326 |
MIM : | 600534 |
Uniprot ID : | Q10589 |
Chromosome Location : | 19p13.2 |
Function : | protein homodimerization activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
Bst2-300M | Recombinant Mouse Bst2 protein(Thr52-Asn151), His-tagged | +Inquiry |
BST2-683R | Recombinant Rat BST2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BST2-2832H | Recombinant Human BST2 Protein, MYC/DDK-tagged | +Inquiry |
BST2-136H | Recombinant Human BST2 Protein, His-tagged | +Inquiry |
BST2-3569H | Recombinant Human BST2, His-tagged | +Inquiry |
◆ Lysates | ||
BST2-1242HCL | Recombinant Human BST2 cell lysate | +Inquiry |
BST2-1623MCL | Recombinant Mouse BST2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All BST2 Products
Required fields are marked with *
My Review for All BST2 Products
Required fields are marked with *
0
Inquiry Basket