Recombinant Human CACNB1, His-tagged
Cat.No. : | CACNB1-26767TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 395-598 of Human CACNB1 with N terminal His tag; 204 amino acids, 34kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle. |
Form : | Lyophilised:Reconstitute with 62 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALA ASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGEL GQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAY TELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWED EEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNEL EGWGRGVYIR |
Sequence Similarities : | Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain. |
Gene Name : | CACNB1 calcium channel, voltage-dependent, beta 1 subunit [ Homo sapiens ] |
Official Symbol : | CACNB1 |
Synonyms : | CACNB1; calcium channel, voltage-dependent, beta 1 subunit; CACNLB1; voltage-dependent L-type calcium channel subunit beta-1; |
Gene ID : | 782 |
mRNA Refseq : | NM_000723 |
Protein Refseq : | NP_000714 |
MIM : | 114207 |
Uniprot ID : | Q02641 |
Chromosome Location : | 17q21-q22 |
Pathway : | Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; |
Function : | high voltage-gated calcium channel activity; voltage-gated calcium channel activity; voltage-gated ion channel activity; |
Products Types
◆ Recombinant Protein | ||
Cacnb1-736M | Recombinant Mouse Cacnb1 Protein, MYC/DDK-tagged | +Inquiry |
CACNB1-2262H | Recombinant Human CACNB1 Protein, MYC/DDK-tagged | +Inquiry |
CACNB1-1173M | Recombinant Mouse CACNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNB1-0270H | Recombinant Human CACNB1 Protein, GST-Tagged | +Inquiry |
CACNB1-732R | Recombinant Rat CACNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CACNB1-7903HCL | Recombinant Human CACNB1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionCACNB1 can enhance the open probability of associated calcium channels, thereby modulating calcium influx into cells.
Dysfunctions or mutations in CACNB1 have been linked to certain cardiac and neurological disorders.
CACNB1 interacts with the alpha-1 subunit of calcium channels, and potentially other regulatory proteins, to modulate channel activity.
Certain mutations in the CACNB1 gene can lead to altered channel activity, potentially causing or contributing to disease states.
CACNB1 acts as an auxiliary subunit of voltage-gated calcium channels, modulating their activity and surface expression.
CACNB1 is expressed in a variety of tissues, but it is particularly prevalent in the heart and central nervous system.
Post-translational modifications like phosphorylation have been identified on CACNB1, which can influence its function and interactions.
Customer Reviews (3)
Write a reviewFast turnaround, crucial for meeting project deadlines.
Dependable source for all our protein research needs.
Efficient sample handling, simplifies our workflow.
Ask a Question for All CACNB1 Products
Required fields are marked with *
My Review for All CACNB1 Products
Required fields are marked with *
Inquiry Basket