Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CACNB1, His-tagged

Cat.No. : CACNB1-26767TH
Product Overview : Recombinant fragment, corresponding to amino acids 395-598 of Human CACNB1 with N terminal His tag; 204 amino acids, 34kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.
Conjugation : HIS
Source : E. coli
Tissue specificity : Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle.
Form : Lyophilised:Reconstitute with 62 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALA ASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGEL GQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAY TELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWED EEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNEL EGWGRGVYIR
Sequence Similarities : Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain.
Gene Name : CACNB1 calcium channel, voltage-dependent, beta 1 subunit [ Homo sapiens ]
Official Symbol : CACNB1
Synonyms : CACNB1; calcium channel, voltage-dependent, beta 1 subunit; CACNLB1; voltage-dependent L-type calcium channel subunit beta-1;
Gene ID : 782
mRNA Refseq : NM_000723
Protein Refseq : NP_000714
MIM : 114207
Uniprot ID : Q02641
Chromosome Location : 17q21-q22
Pathway : Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem;
Function : high voltage-gated calcium channel activity; voltage-gated calcium channel activity; voltage-gated ion channel activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
How does CACNB1 modulate the activity of calcium channels? 01/01/2019

CACNB1 can enhance the open probability of associated calcium channels, thereby modulating calcium influx into cells.

Have any specific diseases been linked to CACNB1 dysfunction or mutation? 12/21/2018

Dysfunctions or mutations in CACNB1 have been linked to certain cardiac and neurological disorders.

Are there other proteins or co-factors that interact with CACNB1 to regulate its function? 09/08/2018

CACNB1 interacts with the alpha-1 subunit of calcium channels, and potentially other regulatory proteins, to modulate channel activity.

Are there any known genetic mutations in the CACNB1 gene that impact channel regulation or other functions? 05/14/2018

Certain mutations in the CACNB1 gene can lead to altered channel activity, potentially causing or contributing to disease states.

What is the primary function of CACNB1 in relation to voltage-gated calcium channels? 05/11/2018

CACNB1 acts as an auxiliary subunit of voltage-gated calcium channels, modulating their activity and surface expression.

In which specific human tissues or cell types is CACNB1 most commonly expressed? 12/28/2017

CACNB1 is expressed in a variety of tissues, but it is particularly prevalent in the heart and central nervous system.

What post-translational modifications have been documented on CACNB1? 12/06/2016

Post-translational modifications like phosphorylation have been identified on CACNB1, which can influence its function and interactions.

Customer Reviews (3)

Write a review
Reviews
06/14/2022

    Fast turnaround, crucial for meeting project deadlines.

    12/28/2021

      Dependable source for all our protein research needs.

      05/12/2021

        Efficient sample handling, simplifies our workflow.

        Ask a Question for All CACNB1 Products

        Required fields are marked with *

        My Review for All CACNB1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends