Recombinant Human CBS, His-tagged
Cat.No. : | CBS-27861TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 242-551 of Human CBS with N terminal His tag; MWt 38kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. Multiple alternatively spliced transcript variants have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney. |
Form : | Lyophilised:Reconstitute with 153 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVD PEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTV VDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVA VKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKG FLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTI EILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKV QPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALV VHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERD QK |
Sequence Similarities : | Belongs to the cysteine synthase/cystathionine beta-synthase family.Contains 1 CBS domain. |
Gene Name : | CBS cystathionine-beta-synthase [ Homo sapiens ] |
Official Symbol : | CBS |
Synonyms : | CBS; cystathionine-beta-synthase; cystathionine beta-synthase; HIP4; |
Gene ID : | 875 |
mRNA Refseq : | NM_000071 |
Protein Refseq : | NP_000062 |
MIM : | 613381 |
Uniprot ID : | P35520 |
Chromosome Location : | 21q22.3 |
Pathway : | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Cysteine biosynthesis, homocysteine + serine => cysteine, organism-specific biosystem; Cysteine biosynthesis, homocysteine + serine => |
Function : | cystathionine beta-synthase activity; enzyme binding; heme binding; heme binding; lyase activity; |
Products Types
◆ Recombinant Protein | ||
CBS-111C | Recombinant Cynomolgus Monkey CBS Protein, His (Fc)-Avi-tagged | +Inquiry |
CBS-0471H | Recombinant Human CBS Protein, GST-Tagged | +Inquiry |
CBS-819R | Recombinant Rat CBS Protein, His (Fc)-Avi-tagged | +Inquiry |
Cbs-827M | Recombinant Mouse Cbs Protein, MYC/DDK-tagged | +Inquiry |
CBS-1960M | Recombinant Mouse CBS Protein (2-561 aa), His-tagged | +Inquiry |
◆ Lysates | ||
CBS-7809HCL | Recombinant Human CBS 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1113 | Cystathionine β Synthase Activity Assay Kit (Fluorometric) | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CBS Products
Required fields are marked with *
My Review for All CBS Products
Required fields are marked with *
0
Inquiry Basket