Recombinant Human CCT4, His-tagged
Cat.No. : | CCT4-27952TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 266-539 of Human TCP1 delta with a N terminal His tag; predicted MWt 31 kDa: |
- Specification
- Gene Information
- Related Products
Description : | The chaperonin containing TCP1 (MIM 186980) complex (CCT), also called the TCP1 ring complex, consists of 2 back-to-back rings, each containing 8 unique but homologous subunits, such as CCT4. CCT assists the folding of newly translated polypeptide substrates through multiple rounds of ATP-driven release and rebinding of partially folded intermediate forms. Substrates of CCT include the cytoskeletal proteins actin (see MIM 102560) and tubulin (see MIM 191130), as well as alpha-transducin (MIM 139330) (Won et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 156 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLIQKSIL RDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTK PVAHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCAS PGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRAL IAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAME VIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRK GGISNILEELVVQPLLVSVSALTLATETVRSILKIDDV VNTR |
Gene Name : | CCT4 chaperonin containing TCP1, subunit 4 (delta) [ Homo sapiens ] |
Official Symbol : | CCT4 |
Synonyms : | CCT4; chaperonin containing TCP1, subunit 4 (delta); T-complex protein 1 subunit delta; Cctd; |
Gene ID : | 10575 |
mRNA Refseq : | NM_006430 |
Protein Refseq : | NP_006421 |
MIM : | 605142 |
Uniprot ID : | P50991 |
Chromosome Location : | 2p15 |
Pathway : | Association of TriC/CCT with target proteins during biosynthesis, organism-specific biosystem; Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Folding of actin by CCT/TriC, organism-specific biosystem; Formation of tubulin folding intermediates by CCT/TriC, organism-specific biosystem; |
Function : | ATP binding; nucleotide binding; unfolded protein binding; |
Products Types
◆ Recombinant Protein | ||
CCT4-1428M | Recombinant Mouse CCT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCT4-0712H | Recombinant Human CCT4 Protein, GST-Tagged | +Inquiry |
CCT4-891R | Recombinant Rat CCT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cct4-804M | Recombinant Mouse Cct4 Protein, MYC/DDK-tagged | +Inquiry |
CCT4-7090C | Recombinant Chicken CCT4 | +Inquiry |
◆ Lysates | ||
CCT4-7688HCL | Recombinant Human CCT4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket