Recombinant Human CD27
Cat.No. : | CD27-26925TH |
Product Overview : | Recombinant full length Human CD27 with N terminal proprietary tag; Predicted MWt 54.34 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor. |
Protein length : | 260 amino acids |
Molecular Weight : | 54.340kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Found in most T-lymphocytes. |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCC QMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPH CESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTEC DPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHM QTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMF LVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREE EGSTIPIQEDYRKPEPACSP |
Sequence Similarities : | Contains 3 TNFR-Cys repeats. |
Gene Name : | CD27 CD27 molecule [ Homo sapiens ] |
Official Symbol : | CD27 |
Synonyms : | CD27; CD27 molecule; TNFRSF7, tumor necrosis factor receptor superfamily, member 7; CD27 antigen; S152; Tp55; |
Gene ID : | 939 |
mRNA Refseq : | NM_001242 |
Protein Refseq : | NP_001233 |
MIM : | 186711 |
Uniprot ID : | P26842 |
Chromosome Location : | 12p13 |
Pathway : | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function : | cysteine-type endopeptidase inhibitor activity involved in apoptotic process; protein binding; receptor activity; transmembrane signaling receptor activity; |
Products Types
◆ Recombinant Protein | ||
CD27-946R | Recombinant Rat CD27 Protein (Met1-Arg183), HlgG1 Fc-tagged | +Inquiry |
CD27-622H | Recombinant Human CD27 Protein, Fc-tagged | +Inquiry |
CD27-06H | Active Recombinant Human CD27 Protein, hIgG/His-tagged | +Inquiry |
Cd27-365M | Recombinant Mouse Cd27 Protein, His&GST-tagged | +Inquiry |
Cd27-3273M | Active Recombinant Mouse Cd27 protein(Met1-Arg182), His-tagged | +Inquiry |
◆ Lysates | ||
CD27-1156CCL | Recombinant Cynomolgus CD27 cell lysate | +Inquiry |
CD27-1383HCL | Recombinant Human CD27 cell lysate | +Inquiry |
CD27-001HCL | Recombinant Human CD27 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CD27 Products
Required fields are marked with *
My Review for All CD27 Products
Required fields are marked with *
0
Inquiry Basket