Recombinant Human CD38
| Cat.No. : | CD38-27749TH |
| Product Overview : | Recombinant full length Human CD38 with a N terminal proprietary tag: predicted molecular weight 59.11 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | CD38 is a novel multifunctional ectoenzyme widely expressed in cells and tissues especially in leukocytes. CD38 also functions in cell adhesion,signal transduction and calcium signaling. |
| Protein length : | 300 amino acids |
| Molecular Weight : | 59.110kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Expressed at high levels in pancreas, liver, kidney, brain, testis, ovary, placenta, malignant lymphoma and neuroblastoma. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLA VVVPRWRQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHV DCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWC GEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHAMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEA WVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR PDKFLQCVKNPEDSSCTSEI |
| Sequence Similarities : | Belongs to the ADP-ribosyl cyclase family. |
| Gene Name : | CD38 CD38 molecule [ Homo sapiens ] |
| Official Symbol : | CD38 |
| Synonyms : | CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase; |
| Gene ID : | 952 |
| mRNA Refseq : | NM_001775 |
| Protein Refseq : | NP_001766 |
| MIM : | 107270 |
| Uniprot ID : | P28907 |
| Chromosome Location : | 4p15.32 |
| Pathway : | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function : | NAD+ nucleosidase activity; hydrolase activity, acting on glycosyl bonds; nucleotide binding; phosphorus-oxygen lyase activity; receptor activity; |
Products Types
| ◆ Recombinant Protein | ||
| CD38-0797H | Recombinant Human CD38 Protein, GST-Tagged | +Inquiry |
| CD38-907R | Recombinant Rat CD38 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cd38-1459M | Recombinant Mouse Cd38 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD38-194H | Recombinant Human CD38 Protein, His-tagged | +Inquiry |
| CD38-30H | Recombinant Human CD38 Protein (ECD), His-tagged(C-ter) | +Inquiry |
| ◆ Lysates | ||
| CD38-1398CCL | Recombinant Cynomolgus CD38 cell lysate | +Inquiry |
| CD38-1557HCL | Recombinant Human CD38 cell lysate | +Inquiry |
| CD38-2639MCL | Recombinant Mouse CD38 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
