Recombinant Human CD3E

• Cat.No.: CD3E-26926TH
• Product Overview: Recombinant full length mature Human CD3 epsilon with N terminal proprietary tag; predicted MWt 46.46 kDa inclusive of tag

Specification

• Description: The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
• Protein length: 185 amino acids
• Molecular Weight: 46.460kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRN DKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRG SKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITG GLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPP VPNPDYEPIRKGQRDLYSGLNQRRI
• Sequence Similarities: Contains 1 Ig-like (immunoglobulin-like) domain.Contains 1 ITAM domain.

Gene Information

• Gene Name: CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ]
• Official Symbol: CD3E
• Synonyms: CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain
• Gene ID: 916
• mRNA Refseq: NM_000733
• Protein Refseq: NP_000724
• Uniprot ID: P07766
• Chromosome Location: 11q23
• Pathway: Adaptive Immune System, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem
• Function: SH3 domain binding; T cell receptor binding; protein heterodimerization activity; protein kinase binding; receptor activity