Recombinant Human CD69
Cat.No. : | CD69-27505TH |
Product Overview : | Recombinant fragment corresponding to amino acids 90-199 of Human CD69 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDM NFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTG SDKCVFLKNTEVSSMECEKNLYWICNKPYK |
Sequence Similarities : | Contains 1 C-type lectin domain. |
Gene Name : | CD69 CD69 molecule [ Homo sapiens ] |
Official Symbol : | CD69 |
Synonyms : | CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; |
Gene ID : | 969 |
mRNA Refseq : | NM_001781 |
Protein Refseq : | NP_001772 |
MIM : | 107273 |
Uniprot ID : | Q07108 |
Chromosome Location : | 12p13 |
Function : | binding; sugar binding; transmembrane signaling receptor activity; |
Products Types
◆ Recombinant Protein | ||
CD69-0844H | Recombinant Human CD69 Protein, GST-Tagged | +Inquiry |
Cd69-846M | Recombinant Mouse Cd69 Protein, MYC/DDK-tagged | +Inquiry |
Cd69-695R | Recombinant Rat Cd69 Protein, His-tagged | +Inquiry |
CD69-3101H | Recombinant Human CD69 Protein, MYC/DDK-tagged | +Inquiry |
CD69-205H | Recombinant Human CD69 Protein, C-His-tagged | +Inquiry |
◆ Lysates | ||
CD69-2573HCL | Recombinant Human CD69 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket