Recombinant Human CEACAM8
Cat.No. : | CEACAM8-27504TH |
Product Overview : | Recombinant full length Human CD66b with N terminal proprietary tag; Predicted MWt 64.39 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) also known as CD66b (Cluster of Differentiation 66b), is a human gene. |
Protein length : | 349 amino acids |
Molecular Weight : | 64.390kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEA VPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRII GYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSY TLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDK DAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTL TLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAP TISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQY TQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD ALVQGSSPGLSARATVSIMIGVLARVALI |
Sequence Similarities : | Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name : | CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ] |
Official Symbol : | CEACAM8 |
Synonyms : | CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b; |
Gene ID : | 1088 |
mRNA Refseq : | NM_001816 |
Protein Refseq : | NP_001807 |
Uniprot ID : | P31997 |
Chromosome Location : | 19q13.2 |
Products Types
◆ Recombinant Protein | ||
CEACAM8-04H | Recombinant human CEACAM8 protein, His-tagged | +Inquiry |
CEACAM8-180H | Recombinant Human CEACAM8 Protein, His-tagged | +Inquiry |
CEACAM8-1162H | Recombinant Human CEACAM8 Protein, His-SUMO-tagged | +Inquiry |
CEACAM8-734H | Recombinant Human CEACAM8 Protein, His-tagged | +Inquiry |
CEACAM8-1098H | Recombinant Human CEACAM8 Protein, GST-Tagged | +Inquiry |
◆ Lysates | ||
CEACAM8-2246HCL | Recombinant Human CEACAM8 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionGenetic variations in CEACAM8 affect immune function and infection susceptibility.
It aids neutrophil adhesion, migration, and antibacterial functions.
CEACAM8 plays a role in regulating inflammation and immune responses.
CEACAM8 works with other adhesion molecules, impacting immune cell signaling.
Altered CEACAM8 expression is linked to autoimmune diseases and chronic inflammation.
Targeting CEACAM8 offers potential treatments for immune-related conditions.
CEACAM8 is key in immune cell activation and signaling, especially in neutrophils.
Customer Reviews (3)
Write a reviewTrusted partner. Contributes to our research discoveries.
Essential for research milestones. Highly recommended service.
Efficient and accurate. A research game-changer.
Ask a Question for All CEACAM8 Products
Required fields are marked with *
My Review for All CEACAM8 Products
Required fields are marked with *
Inquiry Basket