Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CEACAM8

Cat.No. : CEACAM8-27504TH
Product Overview : Recombinant full length Human CD66b with N terminal proprietary tag; Predicted MWt 64.39 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) also known as CD66b (Cluster of Differentiation 66b), is a human gene.
Protein length : 349 amino acids
Molecular Weight : 64.390kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEA VPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRII GYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSY TLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDK DAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTL TLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAP TISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQY TQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD ALVQGSSPGLSARATVSIMIGVLARVALI
Sequence Similarities : Belongs to the immunoglobulin superfamily. CEA family.Contains 2 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name : CEACAM8 carcinoembryonic antigen-related cell adhesion molecule 8 [ Homo sapiens ]
Official Symbol : CEACAM8
Synonyms : CEACAM8; carcinoembryonic antigen-related cell adhesion molecule 8; CGM6; CD66b;
Gene ID : 1088
mRNA Refseq : NM_001816
Protein Refseq : NP_001807
Uniprot ID : P31997
Chromosome Location : 19q13.2

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
How do genetic variations in the CEACAM8 gene affect immune response and susceptibility to infections? 07/24/2022

Genetic variations in CEACAM8 affect immune function and infection susceptibility.

How does CEACAM8 contribute to the activation and function of neutrophils? 12/24/2021

It aids neutrophil adhesion, migration, and antibacterial functions.

What role does CEACAM8 play in inflammatory processes and immune regulation? 09/09/2021

CEACAM8 plays a role in regulating inflammation and immune responses.

How does CEACAM8 interact with other cell adhesion molecules and signaling pathways in the immune system? 09/06/2021

CEACAM8 works with other adhesion molecules, impacting immune cell signaling.

What is the impact of altered CEACAM8 expression in autoimmune disorders and chronic inflammation? 03/22/2020

Altered CEACAM8 expression is linked to autoimmune diseases and chronic inflammation.

What potential therapeutic applications could arise from targeting CEACAM8 in immune-related diseases? 06/08/2019

Targeting CEACAM8 offers potential treatments for immune-related conditions.

What is the primary function of CEACAM8 in immune response and cell signaling? 07/07/2017

CEACAM8 is key in immune cell activation and signaling, especially in neutrophils.

Customer Reviews (3)

Write a review
Reviews
12/24/2021

    Trusted partner. Contributes to our research discoveries.

    09/09/2021

      Essential for research milestones. Highly recommended service.

      07/07/2017

        Efficient and accurate. A research game-changer.

        Ask a Question for All CEACAM8 Products

        Required fields are marked with *

        My Review for All CEACAM8 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends