Recombinant Human CES1
Cat.No. : | CES1-29351TH |
Product Overview : | Recombinant full length Human Liver Carboxylesterase 1 with N terminal proprietary tag; Predicted MWt 87.67 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene. |
Protein length : | 567 amino acids |
Molecular Weight : | 87.670kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed predominantly in liver with lower levels in heart and lung. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MWLPALVLATLAASAAWGHPSSPPVVDTVHGKVLGKFVSL EGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNA TSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAH ENVVVVTIQYRLGTWGFFSTGDEHSRGNWGHLDQVAALRW VQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSA VMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLG TVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP MLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATE KYLGGTDDTVKKKDLFLDLIADVMFGVPSVIVARNHRDAG APTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFL KEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYN QKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQ TEHIEL |
Sequence Similarities : | Belongs to the type-B carboxylesterase/lipase family. |
Gene Name : | CES1 carboxylesterase 1 [ Homo sapiens ] |
Official Symbol : | CES1 |
Synonyms : | CES1; carboxylesterase 1; carboxylesterase 1 (monocyte/macrophage serine esterase 1); liver carboxylesterase 1; CEH; CES1A1; CES1A2; CES2; HMSE; HMSE1; human monocyte/macrophage serine esterase 1; SES1; |
Gene ID : | 1066 |
mRNA Refseq : | NM_001025194 |
Protein Refseq : | NP_001020365 |
Uniprot ID : | P23141 |
Chromosome Location : | 16q22.2 |
Pathway : | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Irinotecan Pathway, organism-specific biosystem; |
Function : | carboxylesterase activity; hydrolase activity; methyl indole-3-acetate esterase activity; methyl jasmonate esterase activity; methyl salicylate esterase activity; |
Products Types
◆ Recombinant Protein | ||
CES1-748H | Active Recombinant Human CES1 Protein, His-tagged | +Inquiry |
CES1-602H | Recombinant Human CES1 Protein, His-tagged | +Inquiry |
CES1-106H | Active Recombinant Human CES1 Protein | +Inquiry |
CES1-1148H | Recombinant Human CES1 Protein, GST-Tagged | +Inquiry |
CES1-579H | Recombinant Human CES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CES1-7564HCL | Recombinant Human CES1 293 Cell Lysate | +Inquiry |
CES1-7565HCL | Recombinant Human CES1 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-0207 | Carboxylesterase 1 Activity Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionCES1 hydrolyzes ester and amide bonds in various compounds, including drugs, xenobiotics, and endogenous molecules.
CES1 is most abundantly expressed in the liver, playing a significant role in first-pass metabolism.
It metabolizes numerous ester-containing drugs, affecting their pharmacokinetics and pharmacodynamics.
CES1 is crucial for the activation of certain prodrugs, converting them into their active pharmacological forms.
Genetic variations in CES1 can lead to inter-individual differences in drug metabolism, impacting efficacy and toxicity.
Certain compounds can inhibit or activate CES1, altering the metabolism of its substrates.
It participates in the hydrolysis of triglycerides and cholesterol esters, contributing to lipid homeostasis.
Customer Reviews (3)
Write a reviewReliable for lab work.
Great value for quality.
Good quality, great service.
Ask a Question for All CES1 Products
Required fields are marked with *
My Review for All CES1 Products
Required fields are marked with *
Inquiry Basket