Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CES1

Cat.No. : CES1-29351TH
Product Overview : Recombinant full length Human Liver Carboxylesterase 1 with N terminal proprietary tag; Predicted MWt 87.67 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene.
Protein length : 567 amino acids
Molecular Weight : 87.670kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed predominantly in liver with lower levels in heart and lung.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MWLPALVLATLAASAAWGHPSSPPVVDTVHGKVLGKFVSL EGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNA TSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAH ENVVVVTIQYRLGTWGFFSTGDEHSRGNWGHLDQVAALRW VQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSA VMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLG TVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP MLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATE KYLGGTDDTVKKKDLFLDLIADVMFGVPSVIVARNHRDAG APTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFL KEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYN QKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQ TEHIEL
Sequence Similarities : Belongs to the type-B carboxylesterase/lipase family.
Gene Name : CES1 carboxylesterase 1 [ Homo sapiens ]
Official Symbol : CES1
Synonyms : CES1; carboxylesterase 1; carboxylesterase 1 (monocyte/macrophage serine esterase 1); liver carboxylesterase 1; CEH; CES1A1; CES1A2; CES2; HMSE; HMSE1; human monocyte/macrophage serine esterase 1; SES1;
Gene ID : 1066
mRNA Refseq : NM_001025194
Protein Refseq : NP_001020365
Uniprot ID : P23141
Chromosome Location : 16q22.2
Pathway : Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; E2F transcription factor network, organism-specific biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Irinotecan Pathway, organism-specific biosystem;
Function : carboxylesterase activity; hydrolase activity; methyl indole-3-acetate esterase activity; methyl jasmonate esterase activity; methyl salicylate esterase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
What is the primary function of the CES1 enzyme in the human body? 09/01/2022

CES1 hydrolyzes ester and amide bonds in various compounds, including drugs, xenobiotics, and endogenous molecules.

In which tissues or organs is CES1 most abundantly expressed? 07/10/2021

CES1 is most abundantly expressed in the liver, playing a significant role in first-pass metabolism.

How does CES1 contribute to drug metabolism? 09/14/2020

It metabolizes numerous ester-containing drugs, affecting their pharmacokinetics and pharmacodynamics.

What is the significance of CES1 in the metabolism of prodrugs? 05/04/2020

CES1 is crucial for the activation of certain prodrugs, converting them into their active pharmacological forms.

How can genetic variations in the CES1 gene affect drug response? 03/08/2020

Genetic variations in CES1 can lead to inter-individual differences in drug metabolism, impacting efficacy and toxicity.

Are there known inhibitors or activators of CES1, and how might they influence its activity? 04/06/2019

Certain compounds can inhibit or activate CES1, altering the metabolism of its substrates.

What role does CES1 play in lipid metabolism? 02/13/2018

It participates in the hydrolysis of triglycerides and cholesterol esters, contributing to lipid homeostasis.

Customer Reviews (3)

Write a review
Reviews
03/29/2022

    Reliable for lab work.

    09/16/2021

      Great value for quality.

      09/03/2020

        Good quality, great service.

        Ask a Question for All CES1 Products

        Required fields are marked with *

        My Review for All CES1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends