Recombinant Human CETN2, His-tagged
Cat.No. : | CETN2-27957TH |
Product Overview : | Recombinant full length Human Centrin 2 with an N terminal His tag; 192 amino acids with tag, Predicted MWt 21.9 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome.The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. |
Protein length : | 172 amino acids |
Conjugation : | HIS |
Molecular Weight : | 21.900kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASNFKKANMASSSQRKRMS PKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEK DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDE ELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
Sequence Similarities : | Belongs to the centrin family.Contains 4 EF-hand domains. |
Gene Name : | CETN2 centrin, EF-hand protein, 2 [ Homo sapiens ] |
Official Symbol : | CETN2 |
Synonyms : | CETN2; centrin, EF-hand protein, 2; CALT; centrin-2; CEN2; |
Gene ID : | 1069 |
mRNA Refseq : | NM_004344 |
Protein Refseq : | NP_004335 |
MIM : | 300006 |
Uniprot ID : | P41208 |
Chromosome Location : | Xq28 |
Pathway : | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; Loss of proteins required for interphase microtubule organization??from the centrosome, organism-specific biosystem; |
Function : | ATP binding; ATP-dependent helicase activity; G-protein beta/gamma-subunit complex binding; calcium ion binding; nucleic acid binding; |
Products Types
◆ Recombinant Protein | ||
CETN2-754H | Recombinant Human CETN2 Protein, His-tagged | +Inquiry |
CETN2-650R | Recombinant Rhesus Macaque CETN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CETN2-1156H | Recombinant Human CETN2 Protein, GST-Tagged | +Inquiry |
CETN2-1607M | Recombinant Mouse CETN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CETN2-2235H | Recombinant Human CETN2 protein, His-tagged | +Inquiry |
◆ Lysates | ||
CETN2-7561HCL | Recombinant Human CETN2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CETN2 Products
Required fields are marked with *
My Review for All CETN2 Products
Required fields are marked with *
0
Inquiry Basket