Recombinant Human CFH, His-tagged
Cat.No. : | CFH-26763TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 160-463 of Human Factor H with N terminal His tag; 304 amino acids, 35kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed by the liver and secreted in plasma. |
Form : | Lyophilised:Reconstitute with 90 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWS KEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKC NMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDY SPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWI PAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYY SYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPY LENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTC MENGWSPTPRCIRVKTCSKSSIDIENGFISES |
Sequence Similarities : | Contains 20 Sushi (CCP/SCR) domains. |
Gene Name : | CFH complement factor H [ Homo sapiens ] |
Official Symbol : | CFH |
Synonyms : | CFH; complement factor H; H factor 1 (complement) , HF, HF1, HF2; age related maculopathy susceptibility 1; ARMS1; beta 1H; FHL1; H factor 2 (complement); HUS; |
Gene ID : | 3075 |
mRNA Refseq : | NM_000186 |
Protein Refseq : | NP_000177 |
MIM : | 134370 |
Uniprot ID : | P08603 |
Chromosome Location : | 1q32 |
Pathway : | Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Staphylococcus aureus infection, organism-specific biosystem; Staphylococcus aureus infection, conserved biosystem; |
Products Types
◆ Recombinant Protein | ||
Cfh-1612M | Recombinant Mouse Cfh Protein, His (Fc)-Avi-tagged | +Inquiry |
CFH-763H | Recombinant Human CFH Protein, His-tagged | +Inquiry |
CFH-762H | Recombinant Human CFH Protein, His-tagged | +Inquiry |
Cfh-761M | Recombinant Mouse Cfh Protein, His-tagged | +Inquiry |
CFH-1168H | Recombinant Human CFH Protein, GST-Tagged | +Inquiry |
◆ Native Protein | ||
CFH-23H | Active Native Human Complement factor H | +Inquiry |
CFH-115H | Active Native Human Factor H | +Inquiry |
◆ Lysates | ||
CFH-2409HCL | Recombinant Human CFH cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket