Recombinant Human CHMP5, His-tagged
Cat.No. : | CHMP5-27751TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-219 of Human CHMP5, with N terminal His tag; 219 amino acids, 34kDa. |
- Specification
- Gene Information
- Related Products
Description : | CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 151 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDA ELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQ RDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEM KKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYG TPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPE GVPTDTKNKDGVLVDEFGLPQIPAS |
Gene Name : | CHMP5 charged multivesicular body protein 5 [ Homo sapiens ] |
Official Symbol : | CHMP5 |
Synonyms : | CHMP5; charged multivesicular body protein 5; C9orf83, chromatin modifying protein 5 , chromosome 9 open reading frame 83 , SNF7DC2; CGI 34; HSPC177; Vps60; |
Gene ID : | 51510 |
mRNA Refseq : | NM_001195536 |
Protein Refseq : | NP_001182465 |
MIM : | 610900 |
Uniprot ID : | Q9NZZ3 |
Chromosome Location : | 9p13.3 |
Pathway : | ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
CHMP5-1035R | Recombinant Rat CHMP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHMP5-678R | Recombinant Rhesus Macaque CHMP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Chmp5-2151M | Recombinant Mouse Chmp5 Protein, Myc/DDK-tagged | +Inquiry |
CHMP5-1253H | Recombinant Human CHMP5 Protein, GST-Tagged | +Inquiry |
CHMP5-11189H | Recombinant Human CHMP5, GST-tagged | +Inquiry |
◆ Lysates | ||
CHMP5-7530HCL | Recombinant Human CHMP5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CHMP5 Products
Required fields are marked with *
My Review for All CHMP5 Products
Required fields are marked with *
0
Inquiry Basket