Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CHMP5, His-tagged

Cat.No. : CHMP5-27751TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-219 of Human CHMP5, with N terminal His tag; 219 amino acids, 34kDa.
  • Specification
  • Gene Information
  • Related Products
Description : CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 151 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDA ELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQ RDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEM KKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYG TPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPE GVPTDTKNKDGVLVDEFGLPQIPAS
Gene Name : CHMP5 charged multivesicular body protein 5 [ Homo sapiens ]
Official Symbol : CHMP5
Synonyms : CHMP5; charged multivesicular body protein 5; C9orf83, chromatin modifying protein 5 , chromosome 9 open reading frame 83 , SNF7DC2; CGI 34; HSPC177; Vps60;
Gene ID : 51510
mRNA Refseq : NM_001195536
Protein Refseq : NP_001182465
MIM : 610900
Uniprot ID : Q9NZZ3
Chromosome Location : 9p13.3
Pathway : ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem;
Function : protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All CHMP5 Products

Required fields are marked with *

My Review for All CHMP5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends