"CKAP4" Related Products

Recombinant Human CKAP4 protein, His-tagged

Cat.No.: CKAP4-28002TH
Product Overview: Recombinant Human CKAP4(254 - 602 aa) fused with His tag at N-terminal was expressed in E. coli.
Description: CKAP4 played an important role in many functions.
Source: E. coli
Species: Human
Tag: His
Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
AA Sequence: IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVREL VSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQ QKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGET QLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKML RTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV
Purity: >95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name: CKAP4 cytoskeleton-associated protein 4 [ Homo sapiens ]
Official Symbol: CKAP4
Synonyms: CKAP4; cytoskeleton-associated protein 4; CLIMP 63; ERGIC 63; P63; 63 kDa membrane protein; type-II transmembrane protein p63; 63-kDa cytoskeleton-linking membrane protein; transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediate compartment; p63; CLIMP-63; ERGIC-63; MGC99554;
Gene ID: 10970
mRNA Refseq: NM_006825
Protein Refseq: NP_006816
MIM:
UniProt ID: Q07065
Chromosome Location: 12q23.3
Pathway: Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.