"CLTC" Related Products

Expand

Recombinant Human CLTC, GST-tagged

Cat.No.: CLTC-26707TH
Product Overview: Human CLTC partial ORF (NP_004850, 232 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
Description: Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Molecular Mass: 37.73 kDa
AA Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
Applications: AP; Array; ELISA; WB-Re
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: Clathrin heavy chain [ Homo sapiens (human) ]
Official Symbol: CLTC
Synonyms: CHC; CHC17; CLH-17; CLTCL2; Hc; KIAA0034
Gene ID: 1213
mRNA Refseq: NM_004859
Protein Refseq: NP_004850
MIM: 118955
UniProt ID: Q00610
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.