Recombinant Human CNR1

• Cat.No.: CNR1-27264TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-110 of Human Cannabinoid Receptor I with an N terminal proprietary tag; Predicted MWt 37.73 kDa inclusive of tag.

Specification

• Description: This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Widely expressed.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASK LGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITE FYNKSLSSFKENEENIQCGENFMDIECFMV
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.

Gene Information

• Gene Name: CNR1 cannabinoid receptor 1 (brain) [ Homo sapiens ]
• Official Symbol: CNR1
• Synonyms: CNR1; cannabinoid receptor 1 (brain); CNR; cannabinoid receptor 1; CANN6; CB R; CB1; CB1A; CB1K5
• Gene ID: 1268
• mRNA Refseq: NM_001160226
• Protein Refseq: NP_001153698
• MIM: 114610
• Uniprot ID: P21554
• Chromosome Location: 6q14-q15
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem
• Function: cannabinoid receptor activity; drug binding; receptor activity; signal transducer activity