Recombinant Human CNR2
Cat.No. : | CNR2-26236TH |
Product Overview : | Recombinant full length Human Cannabinoid Receptor II with N terminal proprietary tag; Predicted MWt 65.67 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors. |
Protein length : | 360 amino acids |
Molecular Weight : | 65.670kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Preferentially expressed in cells of the immune system with higher expression in B cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spl |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLC TLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAG ADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFT ASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGI MWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLL FIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGM ARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLS DQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHH CLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDS RDLDLSDC |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name : | CNR2 cannabinoid receptor 2 (macrophage) [ Homo sapiens ] |
Official Symbol : | CNR2 |
Synonyms : | CNR2; cannabinoid receptor 2 (macrophage); cannabinoid receptor 2; CB2; |
Gene ID : | 1269 |
mRNA Refseq : | NM_001841 |
Protein Refseq : | NP_001832 |
MIM : | 605051 |
Uniprot ID : | P34972 |
Chromosome Location : | 1p |
Pathway : | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
Function : | cannabinoid receptor activity; receptor activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
CNR2-738H | Recombinant Human CNR2 protein(Met1-Cys360) | +Inquiry |
Cnr2-29R | Recombinant Rat Cnr2 Protein, His-tagged | +Inquiry |
CNR2-2703H | Recombinant Human CNR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNR2-1823M | Recombinant Mouse CNR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNR2-3678M | Recombinant Mouse CNR2 Protein | +Inquiry |
◆ Lysates | ||
CNR2-7394HCL | Recombinant Human CNR2 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1181 | cAMP CNR2 (CB2) CHO-K1 GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket