Recombinant Human CTNNA2, His-tagged
Cat.No. : | CTNNA2-27148TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 681-905 of Human alpha 2 Catenin isoform 2, with N terminal His tag, 225aa, MWt 26kDa, |
- Specification
- Gene Information
- Related Products
Description : | It has been shown that alpha N-catenin, a linker between cadherin adhesion receptors and the actin cytoskeleton, is essential for stabilizing dendritic spines in rodent hippocampal neurons in culture. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 80 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKL ARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSKVK AEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKA SYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKP EEFQTRVRRGSQKKHISPVQALSEFKAMDSF |
Gene Name : | CTNNA2 catenin (cadherin-associated protein), alpha 2 [ Homo sapiens ] |
Official Symbol : | CTNNA2 |
Synonyms : | CTNNA2; catenin (cadherin-associated protein), alpha 2; catenin alpha-2; cadherin associated protein; related; cancer/testis antigen 114; CAP R; CT114; |
Gene ID : | 1496 |
mRNA Refseq : | NM_004389 |
Protein Refseq : | NP_004380 |
MIM : | 114025 |
Uniprot ID : | P26232 |
Chromosome Location : | 2p12-p11.1 |
Pathway : | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; |
Function : | cadherin binding; protein binding; structural constituent of cytoskeleton; |
Products Types
◆ Recombinant Protein | ||
CTNNA2-2078H | Recombinant Human CTNNA2 Protein, GST-tagged | +Inquiry |
CTNNA2-2056M | Recombinant Mouse CTNNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ctnna2-778M | Recombinant Mouse Ctnna2 Protein, MYC/DDK-tagged | +Inquiry |
CTNNA2-904R | Recombinant Rhesus Macaque CTNNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTNNA2-6693C | Recombinant Chicken CTNNA2 | +Inquiry |
◆ Lysates | ||
CTNNA2-7202HCL | Recombinant Human CTNNA2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket