Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-097-1828   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human CTSE

Recombinant Human CTSE

   Share
"CTSE" Related Products.
By Species
Human(7)
Mouse(7)
Rat(4)
By Source
+Expand -Collapse
By Tag
GST(1)
His(8)
Cat.No.:
CTSE-26489TH
Product Overview:
Recombinant full length mature Human Cathepsin E, isoform 1 with N terminal propretary tag, 67.8kDa.
Description:
The protein encoded by this gene is a gastric aspartyl protease that functions as a disulfide-linked homodimer. This protease, which is a member of the peptidase C1 family, has a specificity similar to that of pepsin A and cathepsin D. It is an intracellular proteinase that does not appear to be involved in the digestion of dietary protein and is found in highest concentration in the surface of epithelial mucus-producing cells of the stomach. It is the first aspartic proteinase expressed in the fetal stomach and is found in more than half of gastric cancers. It appears, therefore, to be an oncofetal antigen. Transcript variants utilizing alternative polyadenylation signals and two transcript variants encoding different isoforms exist for this gene.
Protein length:
379 amino acids
Molecular Weight:
67.800kDa inclusive of tags
Source:
Wheat germ
Tissue specificity:
Expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes.
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
QGSLHRVPLRRHPTLKKKLRARSQLSEFWKSHNLDMIQFT ESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDT GSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSI QYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTLV DAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSV YMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQ IALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQL QNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPT AYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQ FYSVFDRGNNRVGLAPAVP
Sequence Similarities:
Belongs to the peptidase A1 family.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-097-1828
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.