Recombinant Human CTSZ
Cat.No. : | CTSZ-27236TH |
Product Overview : | Recombinant full length Human Cathepsin Z with a N terminal proprietary tag. Predicted MW 59.40kDa |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. |
Protein length : | 303 amino acids |
Molecular Weight : | 59.400kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGD GLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASIT RNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAK DQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGRE KMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY KDGKGARYNLAIEEHCTFGDPIV |
Sequence Similarities : | Belongs to the peptidase C1 family. |
Gene Name : | CTSZ cathepsin Z [ Homo sapiens ] |
Official Symbol : | CTSZ |
Synonyms : | CTSZ; cathepsin Z; CTSX; |
Gene ID : | 1522 |
mRNA Refseq : | NM_001336 |
Protein Refseq : | NP_001327 |
MIM : | 603169 |
Uniprot ID : | Q9UBR2 |
Chromosome Location : | 20q13.32 |
Pathway : | Clathrin derived vesicle budding, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Lysosome Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Function : | cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; |
Products Types
◆ Recombinant Protein | ||
CTSZ-3386H | Recombinant Human CTSZ Protein, MYC/DDK-tagged | +Inquiry |
CTSZ-658H | Active Recombinant Human CTSZ Protein, His-tagged | +Inquiry |
CTSZ-2120H | Recombinant Human CTSZ Protein, GST-tagged | +Inquiry |
Ctsz-2371M | Recombinant Mouse Ctsz Protein, Myc/DDK-tagged | +Inquiry |
CTSZ-4385H | Recombinant Human CTSZ Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CTSZ-1603HCL | Recombinant Human CTSZ cell lysate | +Inquiry |
CTSZ-3020MCL | Recombinant Mouse CTSZ cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket