Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CYB5A, His-tagged

Cat.No. : CYB5A-27557TH
Product Overview : Recombinant full length Human Cytochrome b5 expressed in Saccharomyces cerevisiae; amino acids 1-98 , 11.3kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKF LEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFI IGELHPDDRPKLNKPPEP
Sequence Similarities : Belongs to the cytochrome b5 family.Contains 1 cytochrome b5 heme-binding domain.
Gene Name : CYB5A cytochrome b5 type A (microsomal) [ Homo sapiens ]
Official Symbol : CYB5A
Synonyms : CYB5A; cytochrome b5 type A (microsomal); CYB5, cytochrome b 5 , cytochrome b5 (microsomal); cytochrome b5;
Gene ID : 1528
mRNA Refseq : NM_001190807
Protein Refseq : NP_001177736
MIM : 613218
Uniprot ID : P00167
Chromosome Location : 18q23
Pathway : Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin C (ascorbate) metabolism, organism-specific biosystem; gamma-linolenate biosynthesis II (animals), conserved biosystem;
Function : aldo-keto reductase (NADP) activity; cytochrome-c oxidase activity; enzyme binding; heme binding; metal ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends