Recombinant Human CYP4A11
| Cat.No. : | CYP4A11-26692TH |
| Product Overview : | Recombinant full length Human Cytochrome P450 4A11/22 with N-terminal proprietary tag. Mol Wt 49.76 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
| Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate. |
| Protein length : | 216 amino acids |
| Molecular Weight : | 49.760kDa |
| Source : | Wheat germ |
| Tissue specificity : | Kidney and liver. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLH RQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVE TFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSY RFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVG LMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKC AFRHWQRAQHSRHLP |
| Sequence Similarities : | Belongs to the cytochrome P450 family. |
| Gene Name : | CYP4A11 cytochrome P450, family 4, subfamily A, polypeptide 11 [ Homo sapiens ] |
| Official Symbol : | CYP4A11 |
| Synonyms : | CYP4A11; cytochrome P450, family 4, subfamily A, polypeptide 11; CYP4A2, cytochrome P450, subfamily IVA, polypeptide 11; cytochrome P450 4A11; CYP4AII; |
| Gene ID : | 1579 |
| mRNA Refseq : | NM_000778 |
| Protein Refseq : | NP_000769 |
| MIM : | 601310 |
| Uniprot ID : | Q02928 |
| Chromosome Location : | 1p33 |
| Pathway : | Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; |
| Function : | alkane 1-monooxygenase activity; electron carrier activity; heme binding; metal ion binding; monooxygenase activity; |
Products Types
| ◆ Recombinant Protein | ||
| CYP4A11-2280H | Recombinant Human CYP4A11 Protein, GST-tagged | +Inquiry |
| CYP4A11-73H | Active Recombinant Human CYP4A11 Protein | +Inquiry |
| CYP4A11-191C | Recombinant Cynomolgus Monkey CYP4A11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CYP4A11-84H | Active Recombinant Human CYP4A11 Protein | +Inquiry |
| CYP4A11-445C | Recombinant Cynomolgus CYP4A11 Protein, His-tagged | +Inquiry |
| ◆ Lysates | ||
| CYP4A11-439HCL | Recombinant Human CYP4A11 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
