Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human DARC

Cat.No. : DARC-26807TH
Product Overview : Recombinant full length Human DARC with N-Terminal proprietary Tag. Mol Wt 63.07 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene.
Protein length : 336 amino acids
Molecular Weight : 63.070kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Found in adult kidney, adult spleen, bone marrow and fetal liver. In particular, it is expressed along postcapillary venules throughout the body, except in the adult liver. Erythroid cells and postcapillary venule endothelium are the principle tissues exp
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGD YGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVL SMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGL GSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAG QVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYS TELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPG PWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLP LPEGWFSHLDTLGSKS
Sequence Similarities : Belongs to the G-protein coupled receptor Duffy family.
Gene Name : DARC Duffy blood group, chemokine receptor [ Homo sapiens ]
Official Symbol : DARC
Synonyms : DARC; Duffy blood group, chemokine receptor; Duffy blood group , FY; Duffy antigen/chemokine receptor; CCBP1; CD234; Dfy; GPD;
Gene ID : 2532
mRNA Refseq : NM_001122951
Protein Refseq : NP_001116423
MIM : 613665
Uniprot ID : Q16570
Chromosome Location : 1q21-q22
Pathway : Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Malaria, organism-specific biosystem; Malaria, conserved biosystem;
Function : C-C chemokine binding; G-protein coupled receptor activity; chemokine receptor activity; receptor activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DARC Products

Required fields are marked with *

My Review for All DARC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends