Recombinant Human DDX24, His-tagged
Cat.No. : | DDX24-28324TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 674-859 of Human DDX24 with N terminal His tag; 186 amino acids, 35kDa. |
- Specification
- Gene Information
- Related Products
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which shows little similarity to any of the other known human DEAD box proteins, but shows a high similarity to mouse Ddx24 at the amino acid level. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 115 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIP LFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSW IEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKE LRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESA LSCLSKQKKKKTKKPKEPQPEQPQPSTSAN |
Gene Name : | DDX24 DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [ Homo sapiens ] |
Official Symbol : | DDX24 |
Synonyms : | DDX24; DEAD (Asp-Glu-Ala-Asp) box polypeptide 24; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 24; ATP-dependent RNA helicase DDX24; |
Gene ID : | 57062 |
mRNA Refseq : | NM_020414 |
Protein Refseq : | NP_065147 |
MIM : | 606181 |
Uniprot ID : | Q9GZR7 |
Chromosome Location : | 14q32 |
Function : | ATP binding; ATP-dependent RNA helicase activity; ATP-dependent helicase activity; RNA binding; RNA helicase activity; |
Products Types
◆ Recombinant Protein | ||
DDX24-2476H | Recombinant Human DDX24 Protein, GST-tagged | +Inquiry |
DDX24-11897H | Recombinant Human DDX24 protein, His-tagged | +Inquiry |
DDX24-11898H | Recombinant Human DDX24 protein, GST-tagged | +Inquiry |
◆ Lysates | ||
DDX24-7013HCL | Recombinant Human DDX24 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket