Recombinant Human DIRAS3, His-tagged
Cat.No. : | DIRAS3-27416TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-229 of Human ARHI with N terminal His tag, 31kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells, but not in ovarian and breast cancers. It is an imprinted gene, with monoallelic expression of the paternal allele, which is associated with growth suppression. Thus, this gene appears to be a putative tumor suppressor gene whose function is abrogated in ovarian and breast cancers. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers. |
Form : | Lyophilised:Reconstitute with 132 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRV VVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLL GCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSV TKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDD THREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHM LLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM |
Sequence Similarities : | Belongs to the small GTPase superfamily. Di-Ras family. |
Gene Name : | DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ] |
Official Symbol : | DIRAS3 |
Synonyms : | DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2; |
Gene ID : | 9077 |
mRNA Refseq : | NM_004675 |
Protein Refseq : | NP_004666 |
MIM : | 605193 |
Uniprot ID : | O95661 |
Chromosome Location : | 1p31 |
Function : | GTP binding; GTPase activity; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
DIRAS3-2638H | Recombinant Human DIRAS3 Protein, GST-tagged | +Inquiry |
DIRAS3-764H | Recombinant Human DIRAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DIRAS3-1094R | Recombinant Rhesus Macaque DIRAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DIRAS3-2819H | Recombinant Human DIRAS3 protein, GST-tagged | +Inquiry |
DIRAS3-0267H | Recombinant Human DIRAS3 protein, mFc-tagged | +Inquiry |
◆ Lysates | ||
DIRAS3-779HCL | Recombinant Human DIRAS3 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket