Recombinant Human DNAJC3
Cat.No. : | DNAJC3-26638TH |
Product Overview : | Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). |
Protein length : | 234 amino acids |
Molecular Weight : | 51.850kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed with high level in the pancreas and testis. Also expressed in cell lines with different levels. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS |
Sequence Similarities : | Contains 1 J domain.Contains 9 TPR repeats. |
Gene Name : | DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ] |
Official Symbol : | DNAJC3 |
Synonyms : | DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK; |
Gene ID : | 5611 |
mRNA Refseq : | NM_006260 |
Protein Refseq : | NP_006251 |
MIM : | 601184 |
Uniprot ID : | Q13217 |
Chromosome Location : | 13q32 |
Pathway : | Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Influenza Infection, organism-specific biosystem; |
Function : | binding; chaperone binding; heat shock protein binding; misfolded protein binding; protein kinase inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
DNAJC3-1121R | Recombinant Rhesus Macaque DNAJC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNAJC3-2760H | Recombinant Human DNAJC3 Protein, GST-tagged | +Inquiry |
Dnajc3-006M | Recombinant Mouse Dnajc3 Protein, MYC/DDK-tagged | +Inquiry |
DNAJC3-2387H | Recombinant Human DNAJC3 Protein, MYC/DDK-tagged | +Inquiry |
DNAJC3-1571R | Recombinant Rat DNAJC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket