Recombinant Human ETV5
Cat.No. : | ETV5-26229TH |
Product Overview : | Recombinant fragment of Human ERM / Etv5 with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQR QLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQ GFKQEYHDPLYEHGVPGMPGPPAHGFQSPM |
Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain. |
Gene Name : | ETV5 ets variant 5 [ Homo sapiens ] |
Official Symbol : | ETV5 |
Synonyms : | ETV5; ets variant 5; ets variant gene 5 (ets related molecule); ETS translocation variant 5; ERM; ets related molecule; |
Gene ID : | 2119 |
mRNA Refseq : | NM_004454 |
Protein Refseq : | NP_004445 |
MIM : | 601600 |
Uniprot ID : | P41161 |
Chromosome Location : | 3q28 |
Pathway : | Androgen Receptor Signaling Pathway, organism-specific biosystem; FOXM1 transcription factor network, organism-specific biosystem; IL12 signaling mediated by STAT4, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function : | DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; |
Products Types
◆ Recombinant Protein | ||
ETV5-2883M | Recombinant Mouse ETV5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETV5-3538H | Recombinant Human ETV5 Protein, GST-tagged | +Inquiry |
ETV5-906H | Recombinant Human ETV5 Protein, His&SUMO-tagged | +Inquiry |
ETV5-3278H | Recombinant Human ETV5 Protein (Ser160-Tyr510), N-His tagged | +Inquiry |
ETV5-194H | Recombinant Human ETV5 protein, T7/His-tagged | +Inquiry |
◆ Lysates | ||
ETV5-6520HCL | Recombinant Human ETV5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket