Recombinant Human FAM20C, His-tagged
Cat.No. : | FAM20C-26375TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 509-570 of Human FAM20C with a N terminal His tag; predicted MWt 17kDa. |
- Specification
- Gene Information
- Related Products
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed. |
Form : | Lyophilised:Reconstitute with 112 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVE RDGLHSVVDDDLDTEHRAASAR |
Sequence Similarities : | Belongs to the FAM20 family. |
Gene Name : | FAM20C family with sequence similarity 20, member C [ Homo sapiens ] |
Official Symbol : | FAM20C |
Synonyms : | FAM20C; family with sequence similarity 20, member C; dentin matrix protein 4; DKFZp547D065; DMP4; IMAGE:4942737; |
Gene ID : | 56975 |
mRNA Refseq : | NM_020223 |
Protein Refseq : | NP_064608 |
MIM : | 611061 |
Uniprot ID : | Q8IXL6 |
Chromosome Location : | 7p22.3 |
Products Types
◆ Recombinant Protein | ||
FAM20C-1427R | Recombinant Rhesus Macaque FAM20C Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM20C-369H | Recombinant Human FAM20C Protein, His-tagged | +Inquiry |
FAM20C-3048M | Recombinant Mouse FAM20C Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM20C-5579M | Recombinant Mouse FAM20C Protein | +Inquiry |
FAM20C-1603R | Recombinant Rhesus monkey FAM20C Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All FAM20C Products
Required fields are marked with *
My Review for All FAM20C Products
Required fields are marked with *
0
Inquiry Basket