Recombinant Human FGF13
Cat.No. : | FGF13-27598TH |
Product Overview : | Recombinant full length Human FGF13 containing an N-terminal proprietary tag; Predicted MW 52.69 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Alternative splicing of this gene at the 5 end results in several transcript variants encoding different isoforms with different N-termini. |
Protein length : | 245 amino acids |
Molecular Weight : | 52.690kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Nervous system. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDK NKLNVFSRVKLFGSKKRRRRRPEPQLKGIATKLYSRQGYH LQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK LYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIY RQQQSGRGWYLGLNKEGEIMKGDHVKKNKPAAHFLPKPLK VAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMS HNEST |
Sequence Similarities : | Belongs to the heparin-binding growth factors family. |
Gene Name : | FGF13 fibroblast growth factor 13 [ Homo sapiens ] |
Official Symbol : | FGF13 |
Synonyms : | FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2; |
Gene ID : | 2258 |
mRNA Refseq : | NM_001139498 |
Protein Refseq : | NP_001132970 |
MIM : | 300070 |
Uniprot ID : | Q92913 |
Chromosome Location : | Xq26.3 |
Pathway : | MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem; Melanoma, organism-specific biosystem; Melanoma, conserved biosystem; Pathways in cancer, organism-specific biosystem; |
Function : | growth factor activity; protein kinase activator activity; |
Products Types
◆ Recombinant Protein | ||
FGF13-1983R | Recombinant Rat FGF13 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fgf13-2994M | Recombinant Mouse Fgf13 Protein, Myc/DDK-tagged | +Inquiry |
FGF13-4103H | Recombinant Human FGF13 Protein, GST-tagged | +Inquiry |
FGF13-1517R | Recombinant Rhesus Macaque FGF13 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF13-027H | Recombinant Human FGF13 Protein | +Inquiry |
◆ Lysates | ||
FGF13-6248HCL | Recombinant Human FGF13 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket