Recombinant Human FLT3LG

• Cat.No.: FLT3LG-28905TH
• Product Overview: Recombinant full length extracellular domain of Human Flt3 Ligand protein expressed in modified Human 293 cells, amino acids 27-184.

Specification

• Description: Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al.
• Biological activity: Activity:The ED50 of FLT3LG-28905TH is typically between 0.5 -5.0 ng/ml as measured in a cell proliferation assay using the OCI/AML5 Human leukemia cell line.
• Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
• Storage: Store at +4°C.
• Sequences of amino acids: Theoretical Sequence:TQDCSFQHSPISSDFAVKIRELSDYLLQD YPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSK MQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQE TSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSP RPLEATAPTAPAS

Gene Information

• Gene Name: FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ]
• Official Symbol: FLT3LG
• Synonyms: FLT3LG; fms-related tyrosine kinase 3 ligand
• Gene ID: 2323
• mRNA Refseq: NM_001204502
• Protein Refseq: NP_001191431
• MIM: 600007
• Uniprot ID: P49771
• Chromosome Location: 19q13.3
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Pathways in cancer, organism-specific biosystem
• Function: cytokine activity; receptor binding