Recombinant Human FUT8
Cat.No. : | FUT8-27230TH |
Product Overview : | Recombinant full length Human FUT8 with N terminal proprietary tag, predicted mwt: 89.32 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. |
Protein length : | 575 amino acids |
Molecular Weight : | 89.320kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSS RELSKILAKLERLKQQNEDLRRMAESLRIPEGPIDQGPAI GRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIE NGAKELWFFLQSELKKLKNLEGNELQRHADEFLLDLGHHE RSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQN PKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT LILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVH GDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVD KKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHN RYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ TLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADE IPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE KIETVKYPTYPEAEK |
Sequence Similarities : | Belongs to the glycosyltransferase 23 family.Contains 1 SH3 domain. |
Gene Name : | FUT8 fucosyltransferase 8 (alpha (1,6) fucosyltransferase) [ Homo sapiens ] |
Official Symbol : | FUT8 |
Synonyms : | FUT8; fucosyltransferase 8 (alpha (1,6) fucosyltransferase); alpha-(1,6)-fucosyltransferase; |
Gene ID : | 2530 |
mRNA Refseq : | NM_004480 |
Protein Refseq : | NP_004471 |
MIM : | 602589 |
Uniprot ID : | Q9BYC5 |
Chromosome Location : | 14q24.3 |
Pathway : | Asparagine N-linked glycosylation, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; |
Function : | SH3 domain binding; glycoprotein 6-alpha-L-fucosyltransferase activity; transferase activity, transferring glycosyl groups; |
Products Types
◆ Recombinant Protein | ||
FUT8-4567H | Recombinant Human FUT8 Protein, GST-tagged | +Inquiry |
FUT8-2071R | Recombinant Rat FUT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT8-3394M | Recombinant Mouse FUT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT8-1590R | Recombinant Rhesus Macaque FUT8 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT8-2659H | Recombinant Human FUT8 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
FUT8-497HCL | Recombinant Human FUT8 cell lysate | +Inquiry |
FUT8-001HCL | Recombinant Hamster FUT8 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionYes, altering FUT8 activity can impact cancer cell growth and metastasis, making it a potential target for cancer therapies.
One challenge is the specificity of FUT8 inhibitors, ensuring they do not affect other essential glycosylation processes in the body.
Yes, abnormal glycosylation patterns due to FUT8 alterations can serve as biomarkers for diseases like cancer, aiding in early diagnosis.
FUT8-mediated glycosylation of antibodies can enhance their stability and effector functions, making them more effective in treating diseases like cancer and autoimmune disorders.
Yes, deficiencies in FUT8 have been associated with certain types of cancers and developmental disorders.
Customer Reviews (3)
Write a reviewWith the manufacturer's outstanding technical support, you can be assured that any challenges you encounter will be efficiently addressed.
Researchers who have utilized the FUT8 protein laud its reliability and effectiveness in their studies.
Its superior quality, combined with the manufacturer's exceptional technical support, provides researchers with the confidence they need to conduct successful experiments and obtain meaningful results.
Ask a Question for All FUT8 Products
Required fields are marked with *
My Review for All FUT8 Products
Required fields are marked with *
Inquiry Basket