Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human FUT8

Cat.No. : FUT8-27230TH
Product Overview : Recombinant full length Human FUT8 with N terminal proprietary tag, predicted mwt: 89.32 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants.
Protein length : 575 amino acids
Molecular Weight : 89.320kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSS RELSKILAKLERLKQQNEDLRRMAESLRIPEGPIDQGPAI GRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIE NGAKELWFFLQSELKKLKNLEGNELQRHADEFLLDLGHHE RSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQN PKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT LILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVH GDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVD KKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHN RYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ TLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADE IPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE KIETVKYPTYPEAEK
Sequence Similarities : Belongs to the glycosyltransferase 23 family.Contains 1 SH3 domain.
Gene Name : FUT8 fucosyltransferase 8 (alpha (1,6) fucosyltransferase) [ Homo sapiens ]
Official Symbol : FUT8
Synonyms : FUT8; fucosyltransferase 8 (alpha (1,6) fucosyltransferase); alpha-(1,6)-fucosyltransferase;
Gene ID : 2530
mRNA Refseq : NM_004480
Protein Refseq : NP_004471
MIM : 602589
Uniprot ID : Q9BYC5
Chromosome Location : 14q24.3
Pathway : Asparagine N-linked glycosylation, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem;
Function : SH3 domain binding; glycoprotein 6-alpha-L-fucosyltransferase activity; transferase activity, transferring glycosyl groups;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Can manipulating FUT8 protein have implications in cancer therapy? 03/27/2021

Yes, altering FUT8 activity can impact cancer cell growth and metastasis, making it a potential target for cancer therapies.

Are there any challenges in targeting FUT8 protein for therapeutic interventions? 08/23/2019

One challenge is the specificity of FUT8 inhibitors, ensuring they do not affect other essential glycosylation processes in the body.

Can FUT8 protein modifications be used as biomarkers for certain diseases? 11/30/2018

Yes, abnormal glycosylation patterns due to FUT8 alterations can serve as biomarkers for diseases like cancer, aiding in early diagnosis.

How does FUT8 protein impact the development of therapeutic antibodies? 11/05/2016

FUT8-mediated glycosylation of antibodies can enhance their stability and effector functions, making them more effective in treating diseases like cancer and autoimmune disorders.

Are there any diseases directly linked to FUT8 protein deficiency? 03/12/2016

Yes, deficiencies in FUT8 have been associated with certain types of cancers and developmental disorders.

Customer Reviews (3)

Write a review
Reviews
04/01/2021

    With the manufacturer's outstanding technical support, you can be assured that any challenges you encounter will be efficiently addressed.

    06/30/2020

      Researchers who have utilized the FUT8 protein laud its reliability and effectiveness in their studies.

      05/12/2017

        Its superior quality, combined with the manufacturer's exceptional technical support, provides researchers with the confidence they need to conduct successful experiments and obtain meaningful results.

        Ask a Question for All FUT8 Products

        Required fields are marked with *

        My Review for All FUT8 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends