Recombinant Human GALK2, His-tagged
Cat.No. : | GALK2-28969TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 265-445 of Human GALK2 with N terminal His tag; 191 amino acids, 22kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a highly efficient N-acetylgalactosamine (GalNAc) kinase, which has galactokinase activity when galactose is present at high concentrations. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 114 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LRLEEVQAKLGISLEEMLLVTEDALHPEPYNPEEICRCLG ISLEELRTQILSPNTQDVLIFKLYQRAKHVYSEAARVL QFKKICEEAPENMVQLLGELMNQSHMSCRDMYECSCPELD QLVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFL ANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLL |
Gene Name : | GALK2 galactokinase 2 [ Homo sapiens ] |
Official Symbol : | GALK2 |
Synonyms : | GALK2; galactokinase 2; N-acetylgalactosamine kinase; GK2; |
Gene ID : | 2585 |
mRNA Refseq : | NM_001001556 |
Protein Refseq : | NP_001001556 |
MIM : | 137028 |
Uniprot ID : | Q01415 |
Chromosome Location : | 15 |
Pathway : | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function : | ATP binding; N-acetylgalactosamine kinase activity; galactokinase activity; galactokinase activity; kinase activity; |
Products Types
◆ Recombinant Protein | ||
GALK2-4683H | Recombinant Human GALK2 Protein, GST-tagged | +Inquiry |
GALK2-2118R | Recombinant Rat GALK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALK2-958H | Recombinant Human GALK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Galk2-3138M | Recombinant Mouse Galk2 Protein, Myc/DDK-tagged | +Inquiry |
GALK2-2271C | Recombinant Chicken GALK2 | +Inquiry |
◆ Lysates | ||
GALK2-6042HCL | Recombinant Human GALK2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket