Recombinant Human GNPDA1
Cat.No. : | GNPDA1-28076TH |
Product Overview : | Recombinant full length Human GNPDA1, expressed in Saccharomyces cerevisiae, amino acids 1-289, 33 kDa, |
- Specification
- Gene Information
- Related Products
Description : | Glucosamine-6-phosphate deaminase (EC 3.5.99.6) is an allosteric enzyme that catalyzes the reversible conversion of D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium (Arreola et al. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLP TGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMDEYVGLP RDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQA ECDAFEEKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSR TRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVM DAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQH PRTVFVCDEDATLELKVKTVKY |
Sequence Similarities : | Belongs to the glucosamine/galactosamine-6-phosphate isomerase family. |
Gene Name : | GNPDA1 glucosamine-6-phosphate deaminase 1 [ Homo sapiens ] |
Official Symbol : | GNPDA1 |
Synonyms : | GNPDA1; glucosamine-6-phosphate deaminase 1; glucosamine 6 phosphate isomerase , GNPI; glucosamine-6-phosphate isomerase 1; glucosamine 6 phosphate deaminase; GNPDA; GPI; HLN; KIAA0060; oscillin; |
Gene ID : | 10007 |
mRNA Refseq : | NM_005471 |
Protein Refseq : | NP_005462 |
MIM : | 601798 |
Uniprot ID : | P46926 |
Chromosome Location : | 5q21 |
Pathway : | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function : | glucosamine-6-phosphate deaminase activity; hydrolase activity; |
Products Types
◆ Recombinant Protein | ||
GNPDA1-3782M | Recombinant Mouse GNPDA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNPDA1-1732R | Recombinant Rhesus Macaque GNPDA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNPDA1-5090H | Recombinant Human GNPDA1 Protein, GST-tagged | +Inquiry |
GNPDA1-1912R | Recombinant Rhesus monkey GNPDA1 Protein, His-tagged | +Inquiry |
GNPDA1-2589Z | Recombinant Zebrafish GNPDA1 | +Inquiry |
◆ Lysates | ||
GNPDA1-724HCL | Recombinant Human GNPDA1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All GNPDA1 Products
Required fields are marked with *
My Review for All GNPDA1 Products
Required fields are marked with *
0
Inquiry Basket