Recombinant Human GRIK1

• Cat.No.: GRIK1-28537TH
• Product Overview: Recombinant fragment of Human GRIK1 amino acids 331-440 with a N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag.

Specification

• Description: Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing (CAG->CGG; Q->R) within the second transmembrane domain, which is thought to alter the properties of ion flow. Alternative splicing, resulting in transcript variants encoding different isoforms, has been noted for this gene.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Most abundant in the cerebellum and the suprachiasmatic nuclei (SCN) of the hypothalamus.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWD GLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKH LYKVWKKIGIWNSNSGLNMTDSNKDKSSNI
• Sequence Similarities: Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK1 subfamily.

Gene Information

• Gene Name: GRIK1 glutamate receptor, ionotropic, kainate 1 [ Homo sapiens ]
• Official Symbol: GRIK1
• Synonyms: GRIK1; glutamate receptor, ionotropic, kainate 1; GLUR5; glutamate receptor, ionotropic kainate 1
• Gene ID: 2897
• mRNA Refseq: NM_000830
• Protein Refseq: NP_000821
• MIM: 138245
• Uniprot ID: P39086
• Chromosome Location: 21q22
• Pathway: Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Activation of Na-permeable Kainate Receptors, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem
• Function: drug binding; extracellular-glutamate-gated ion channel activity; glutamate binding; ion channel activity; kainate selective glutamate receptor activity