Recombinant Human GRIK4
Cat.No. : | GRIK4-29879TH |
Product Overview : | Recombinant fragment of Human KA1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSS PASSSIISNICGEKEVPHFKVAPEEFVKFQ |
Sequence Similarities : | Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK4 subfamily. |
Gene Name : | GRIK4 glutamate receptor, ionotropic, kainate 4 [ Homo sapiens ] |
Official Symbol : | GRIK4 |
Synonyms : | GRIK4; glutamate receptor, ionotropic, kainate 4; GRIK; glutamate receptor, ionotropic kainate 4; KA1; |
Gene ID : | 2900 |
mRNA Refseq : | NM_014619 |
Protein Refseq : | NP_055434 |
MIM : | 600282 |
Uniprot ID : | Q16099 |
Chromosome Location : | 11q |
Pathway : | Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Ionotropic activity of Kainate Receptors, organism-specific biosystem; |
Function : | extracellular-glutamate-gated ion channel activity; ion channel activity; kainate selective glutamate receptor activity; receptor activity; |
Products Types
◆ Recombinant Protein | ||
GRIK4-3929M | Recombinant Mouse GRIK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIK4-2352R | Recombinant Rat GRIK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIK4-5340H | Recombinant Human GRIK4 Protein, GST-tagged | +Inquiry |
GRIK4-7267M | Recombinant Mouse GRIK4 Protein | +Inquiry |
GRIK4-2698R | Recombinant Rat GRIK4 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket