Recombinant Human GRPR
Cat.No. : | GRPR-28627TH |
Product Overview : | Recombinant full length Human GRPR (amino acids 1-384) with N terminal proprietary tag; Predicted MWt 68.31 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene. |
Protein length : | 384 amino acids |
Molecular Weight : | 68.310kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highly expressed in pancreas. Also expressed in stomach, adrenal cortex and brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGIL YVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFIS SLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLK AAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYP HSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPN HVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPF ALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS LKSTNPSVATFSLINGNICHERYV |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name : | GRPR gastrin-releasing peptide receptor [ Homo sapiens ] |
Official Symbol : | GRPR |
Synonyms : | GRPR; gastrin-releasing peptide receptor; |
Gene ID : | 2925 |
mRNA Refseq : | NM_005314 |
Protein Refseq : | NP_005305 |
MIM : | 305670 |
Uniprot ID : | P30550 |
Chromosome Location : | Xp22.2 |
Pathway : | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; |
Function : | G-protein coupled peptide receptor activity; bombesin receptor activity; neuropeptide binding; receptor activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
GRPR-5383H | Recombinant Human GRPR Protein, GST-tagged | +Inquiry |
GRPR-1802R | Recombinant Rhesus Macaque GRPR Protein, His (Fc)-Avi-tagged | +Inquiry |
GRPR-3946M | Recombinant Mouse GRPR Protein, His (Fc)-Avi-tagged | +Inquiry |
GRPR-2377R | Recombinant Rat GRPR Protein, His (Fc)-Avi-tagged | +Inquiry |
GRPR-1981R | Recombinant Rhesus monkey GRPR Protein, His-tagged | +Inquiry |
◆ Assay kits | ||
Kit-1337 | GRPR U2OS β-Arrestin GPCR Assay Kit | +Inquiry |
Kit-1338 | GRPR Activated GPCR Internalization Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All GRPR Products
Required fields are marked with *
My Review for All GRPR Products
Required fields are marked with *
0
Inquiry Basket