Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human GRPR

Cat.No. : GRPR-28627TH
Product Overview : Recombinant full length Human GRPR (amino acids 1-384) with N terminal proprietary tag; Predicted MWt 68.31 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene.
Protein length : 384 amino acids
Molecular Weight : 68.310kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highly expressed in pancreas. Also expressed in stomach, adrenal cortex and brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGIL YVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFIS SLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLK AAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYP HSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPN HVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPF ALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS LKSTNPSVATFSLINGNICHERYV
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name : GRPR gastrin-releasing peptide receptor [ Homo sapiens ]
Official Symbol : GRPR
Synonyms : GRPR; gastrin-releasing peptide receptor;
Gene ID : 2925
mRNA Refseq : NM_005314
Protein Refseq : NP_005305
MIM : 305670
Uniprot ID : P30550
Chromosome Location : Xp22.2
Pathway : Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function : G-protein coupled peptide receptor activity; bombesin receptor activity; neuropeptide binding; receptor activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All GRPR Products

Required fields are marked with *

My Review for All GRPR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends