Recombinant Human GUCA1A

• Cat.No.: GUCA1A-28157TH
• Product Overview: Recombinant full length Human GCAP1 with a N terminal proprietary tag; Predicted MW 47.52 kDa.

Specification

• Description: This gene plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein encoded by this gene, guanylyl cyclase activating protein 1 (GCAP1), mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia.
• Protein length: 201 amino acids
• Molecular Weight: 47.520kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Retina; cone outer and inner segments, in particular, in disk membrane regions, and to a lesser extent rod inner and outer segments.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFR QFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAAL SLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIR AINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGV QKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAA G
• Sequence Similarities: Contains 4 EF-hand domains.

Gene Information

• Gene Name: GUCA1A guanylate cyclase activator 1A (retina) [ Homo sapiens ]
• Official Symbol: GUCA1A
• Synonyms: GUCA1A; guanylate cyclase activator 1A (retina); C6orf131, chromosome 6 open reading frame 131 , GUCA, GUCA1; guanylyl cyclase-activating protein 1; COD3; cone dystrophy 3; dJ139D8.6; GCAP; GCAP1
• Gene ID: 2978
• mRNA Refseq: NM_000409
• Protein Refseq: NP_000400
• MIM: 600364
• Uniprot ID: P43080
• Chromosome Location: 6p21.1
• Pathway: Olfactory transduction, organism-specific biosystem; Olfactory transduction, conserved biosystem; Phototransduction, organism-specific biosystem; Phototransduction, conserved biosystem; Visual signal transduction: Cones, organism-specific biosystem
• Function: calcium ion binding; calcium sensitive guanylate cyclase activator activity